"STMN3" Related Products

Expand

Recombinant Human STMN3, His-tagged

Cat.No.: STMN3-31471TH
Product Overview: Recombinant fragment, corresponding to amino acids 27-180 of Human STMN3 with N terminal His tag; 154 amino acids, 25.7kDa.
Description: The protein encoded by this gene belongs to the stathmin/oncoprotein 18 family of microtubule-destabilizing phosphoproteins. It is similar to the SCG10 protein and is involved in signal transduction and regulation of microtubule dynamics.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 164 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: TQPHPNTVYQYGDMEVKQLDKRASGQSFEVILKSPSDLSP ESPMLSSPPKKKDTSLEELQKRLEAAEERRKTQEAQVL KQLAERREHEREVLHKALEENNNFSRQAEEKLNYKMEL SKEIREAHLAALRERLREKELHAAEVRRNKEQREEMSG
Gene Name: STMN3 stathmin-like 3 [ Homo sapiens ]
Official Symbol: STMN3
Synonyms: STMN3; stathmin-like 3; stathmin-3; SCLIP;
Gene ID: 50861
mRNA Refseq: NM_015894
Protein Refseq: NP_056978
MIM: 608362
Uniprot ID: Q9NZ72
Chromosome Location: 20q13.3
Function: protein domain specific binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.