"STOM" Related Products

Expand
Expand

Recombinant Human STOM

Cat.No.: STOM-31472TH
Product Overview: Recombinant fragment of Human STOM with N-terminal proprietary tag. Predicted MW 34.87kDa.
Description: Erythrocyte band 7 integral membrane protein is a protein that in humans is encoded by the STOM gene.
Protein length: 84 amino acids
Molecular Weight: 34.870kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Widely expressed.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: EYERAIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYYRVQNATLAVANITNADSA
Sequence Similarities: Belongs to the band 7/mec-2 family.
Gene Name: STOM stomatin [ Homo sapiens ]
Official Symbol: STOM
Synonyms: STOM; stomatin; EPB7, EPB72, erythrocyte membrane protein band 7.2 (stomatin); erythrocyte band 7 integral membrane protein; BND7;
Gene ID: 2040
mRNA Refseq: NM_004099
Protein Refseq: NP_004090
MIM: 133090
Uniprot ID: P27105
Chromosome Location: 9q34.1

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.