Recombinant Human SUMO2

• Cat.No.: SUMO2-28787TH
• Product Overview: Recombinant full length human Sumo 2 ; 95 amino acids, 11 kDa.

Specification

• Description: This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Source: E. coli
• Tissue specificity: Broadly expressed.
• Form: Lyophilised
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 1X PBS, pH 7.4
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPL SKLMKAYC ERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQ QQTGGVY.
• Sequence Similarities: Belongs to the ubiquitin family. SUMO subfamily.Contains 1 ubiquitin-like domain.

Gene Information

• Gene Name: SUMO2 SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: SUMO2
• Synonyms: SUMO2; SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae); SMT3 (suppressor of mif two 3, yeast) homolog 2 , SMT3 suppressor of mif two 3 homolog 2 (yeast) , SMT3H2; small ubiquitin-related modifier 2; SMT3B
• Gene ID: 6613
• mRNA Refseq: NM_001005849
• Protein Refseq: NP_001005849
• MIM: 603042
• Uniprot ID: P61956
• Chromosome Location: 17q25
• Pathway: Glucocorticoid receptor regulatory network, organism-specific biosystem; Nuclear pore complex, organism-specific biosystem; RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; Wnt Signaling Pathway NetPath, organism-specific biosystem
• Function: protein binding; ubiquitin protein ligase binding