Recombinant Human SYP
Cat.No. : | SYP-31490TH |
Product Overview : | Recombinant full length Human Synaptophysin with N terminal proprietary tag; predicted MWt 60.54 kDa inclusive of tag. AAH64550.1 |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes an integral membrane protein of small synaptic vesicles in brain and endocrine cells. The protein also binds cholesterol and is thought to direct targeting of vesicle-associated membrane protein 2 (synaptobrevin) to intracellular compartments. Mutations in this gene are associated with X-linked mental retardation (XLMR). |
Protein length : | 313 amino acids |
Molecular Weight : | 60.540kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Characteristic of a type of small (30-80 nm) neurosecretory vesicles, including presynaptic vesicles, but also vesicles of various neuroendocrine cells of both neuronal and epithelial phenotype. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAI FAFATCGSYSGELQLNVDCANKTESDLSIEVEFEYPFRLH QVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYS MGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSS AWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDLVT SGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPG APEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDY GQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM |
Sequence Similarities : | Belongs to the synaptophysin/synaptobrevin family.Contains 1 MARVEL domain. |
Gene Name : | SYP synaptophysin [ Homo sapiens ] |
Official Symbol : | SYP |
Synonyms : | SYP; synaptophysin; |
Gene ID : | 6855 |
mRNA Refseq : | NM_003179 |
Protein Refseq : | NP_003170 |
MIM : | 313475 |
Uniprot ID : | P08247 |
Chromosome Location : | Xp11.23-p11.22 |
Function : | SH2 domain binding; calcium ion binding; cholesterol binding; identical protein binding; syntaxin-1 binding; |
Products Types
◆ Recombinant Protein | ||
SYP-2747H | Recombinant Human SYP Protein, His-tagged | +Inquiry |
SYP-4403R | Recombinant Rhesus Macaque SYP Protein, His (Fc)-Avi-tagged | +Inquiry |
SYP-5533R | Recombinant Rat SYP Protein, His (Fc)-Avi-tagged | +Inquiry |
SYP-2596H | Recombinant Human SYP protein(228-313 aa), N-SUMO & N-His-tagged | +Inquiry |
SYP-4587R | Recombinant Rhesus monkey SYP Protein, His-tagged | +Inquiry |
◆ Lysates | ||
SYP-1313HCL | Recombinant Human SYP 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket