Recombinant Human TAC3, His-tagged
Cat.No. : | TAC3-29652TH |
Product Overview : | Recombinant full length Human Neurokinin B with an N terminal His tag; 125 amino acids with a predicted MWt 13.8 kDa including tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the tachykinin family of secreted neuropeptides. The encoded protein is primarily expressed in the central and peripheral nervous system and functions as a neurotransmitter. This protein is the ligand for the neurokinin-3 receptor. This protein is also expressed in the outer syncytiotrophoblast of the placenta and may be associated with pregnancy-induced hypertension and pre-eclampsia. Mutations in this gene are associated with normosmic hypogonadotropic hypogonadism. Alternate splicing results in multiple transcript variants. |
Protein length : | 105 amino acids |
Conjugation : | HIS |
Molecular Weight : | 13.800kDa inclusive of tags |
Source : | E. coli |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol |
Storage : | Please see Notes section |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHQSFGAVCKEPQEEVVPGGGR SKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTS PEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKY PPRAE |
Sequence Similarities : | Belongs to the tachykinin family. |
Gene Name : | TAC3 tachykinin 3 [ Homo sapiens ] |
Official Symbol : | TAC3 |
Synonyms : | TAC3; tachykinin 3; neurokinin beta , neuromedin K , NKNB; tachykinin-3; NKB; ZNEUROK1; |
Gene ID : | 6866 |
mRNA Refseq : | NM_001178054 |
Protein Refseq : | NP_001171525 |
MIM : | 162330 |
Uniprot ID : | Q9UHF0 |
Chromosome Location : | 12q13-q21 |
Pathway : | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem; |
Function : | receptor binding; |
Products Types
◆ Recombinant Protein | ||
Tac3-5805R | Recombinant Rat Tac3 protein, His & GST-tagged | +Inquiry |
TAC3-6390H | Recombinant Human TAC3 Protein (Cys23-Glu121), N-His tagged | +Inquiry |
TAC3-79H | Recombinant Human Tachykinin 3, His-tagged | +Inquiry |
TAC3-29653TH | Recombinant Human TAC3, His-tagged | +Inquiry |
TAC3-3093H | Recombinant Human TAC3, GST-tagged | +Inquiry |
◆ Lysates | ||
TAC3-1287HCL | Recombinant Human TAC3 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket