"TACSTD2" Related Products

Expand
Expand
Expand

Recombinant Human TACSTD2

Cat.No.: TACSTD2-30839TH
Product Overview: Recombinant full length Human TACD2 with N terminal proprietary tag, 58.78kDa.
Description: This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.
Protein length: 298 amino acids
Molecular Weight: 58.780kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Placenta, pancreatic carcinoma cell lines.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDC STLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDP DCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCD ELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRL HPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYF ERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPP KFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKY KKVEIKELGELRKEPSL
Sequence Similarities: Belongs to the EPCAM family.Contains 1 thyroglobulin type-1 domain.
Gene Name: TACSTD2 tumor-associated calcium signal transducer 2 [ Homo sapiens ]
Official Symbol: TACSTD2
Synonyms: TACSTD2; tumor-associated calcium signal transducer 2; M1S1; EGP 1; GA733 1; TROP2;
Gene ID: 4070
mRNA Refseq: NM_002353
Protein Refseq: NP_002344
MIM: 137290
Uniprot ID: P09758
Chromosome Location: 1p32
Function: receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.