"TAGLN" Related Products

Expand
Expand

Recombinant Human TAGLN, His-tagged

Cat.No. : TAGLN-30925TH
Product Overview : Recombinant full length Human SM22 alpha with N terminal His tag; 221 amino acids with tag, MWt 24.8kDa.
Description : The protein encoded by this gene is a transformation and shape-change sensitive actin cross-linking/gelling protein found in fibroblasts and smooth muscle. Its expression is down-regulated in many cell lines, and this down-regulation may be an early and sensitive marker for the onset of transformation. A functional role of this protein is unclear. Two transcript variants encoding the same protein have been found for this gene.
Protein length : 201 amino acids
Conjugation : HIS
Molecular Weight : 24.800kDa inclusive of tags
Source : E. coli
Form : Liquid
Purity : by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS
Sequence Similarities : Belongs to the calponin family.Contains 1 calponin-like repeat.Contains 1 CH (calponin-homology) domain.
Gene Name : TAGLN transgelin [ Homo sapiens ]
Official Symbol : TAGLN
Synonyms : TAGLN; transgelin; DKFZp686P11128; SM22; SM22 alpha; SMCC; TAGLN1; transgelin variant 2; WS3 10;
Gene ID : 6876
mRNA Refseq : NM_001001522
Protein Refseq : NP_001001522
MIM : 600818
Uniprot ID : Q01995
Chromosome Location : 11q23.2
Function : actin binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.