"TBRG4" Related Products

Recombinant Human TBRG4, His-tagged

Cat.No.: TBRG4-29458TH
Product Overview: Recombinant fragment, corresponding to amino acids 41-521 of Human TBRG4 Isoform 2 with N terminal His tag; Predicted MWt 55 kDa.
Conjugation: HIS
Source: E. coli
Tissue specificity: Ubiquitously expressed.
Form: Lyophilised:Reconstitute with 65 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SSATSPISHLPGSLMEPVEKERASTPYIEKQVDHLIKKAT RPEELLELLGGSHDLDSNQAAMVLIRLSHLLSEKPEDK GLLIQDAHFHQLLCLLNSQIASVWHGTLSKLLGSLYAL GIPKASKELQSVEQEVRWRMRKLKYKHLAFLAESCATL SQEQHSQELLAELLTHLERRWTEIEDSHTLVTVMMKVGHL SEPLMNRLEDKHVLNRAQDITLPHLCSVLLAFARLNFH PDQEDQFFSLVHEKLGSELPGLEPALQVDLVWALCVLQ QAREAELQAVLHPEFHIQFLGGKSQKDQNTFQKLLHIN ATALLEYPEYSGPLLPASAVAPGPSALDRKVTPLQKEL QETLKGLLGSADKGSLEVATQYGWVLDAEVLLDSDGEFLP VRDFVAPHLAQPTGSQSPPPGSKRLAFLRWEFPNFNSR SKDLLGRFVLARRHIVAAGFLIVDVPFYEWLELKSEWQ KGAYLKDKMRKAVAEELAK
Sequence Similarities: Belongs to the FAST kinase family.Contains 1 RAP domain.
Gene Name: TBRG4 transforming growth factor beta regulator 4 [ Homo sapiens ]
Official Symbol: TBRG4
Synonyms: TBRG4; transforming growth factor beta regulator 4; protein TBRG4; cell cycle progression 2 protein; Cpr2; FAST kinase domains 4; FASTKD4; H_TD2522F11.8; KIAA0948;
Gene ID: 9238
mRNA Refseq: NM_199122
Protein Refseq: NP_954573
MIM: 611325
Uniprot ID: Q969Z0
Chromosome Location: 7p13
Function: protein kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.