Recombinant Human TCEA1
Cat.No. : | TCEA1-30067TH |
Product Overview : | Recombinant full length Human TCEA1 with N terminal proprietary tag; Predicted MWt 59.18 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Transcription elongation factor A protein 1 is a protein that in humans is encoded by the TCEA1 gene. |
Protein length : | 301 amino acids |
Molecular Weight : | 59.180kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MEDEVVRFAKKMDKMVQKKNAAGALDLLKELKNIPMTLEL LQSTRIGMSVNAIRKQSTDEEVTSLAKSLIKSWKKLLDGP STEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDET NARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIA IGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKD AKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNL TKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRS ADEPMTTFVVCNECGNRWKFC |
Sequence Similarities : | Belongs to the TFS-II family.Contains 1 TFIIS central domain.Contains 1 TFIIS N-terminal domain.Contains 1 TFIIS-type zinc finger. |
Gene Name : | TCEA1 transcription elongation factor A (SII), 1 [ Homo sapiens ] |
Official Symbol : | TCEA1 |
Synonyms : | TCEA1; transcription elongation factor A (SII), 1; GTF2S, TCEA; transcription elongation factor A protein 1; SII; TF2S; TFIIS; |
Gene ID : | 6917 |
mRNA Refseq : | NM_006756 |
Protein Refseq : | NP_006747 |
MIM : | 601425 |
Uniprot ID : | P23193 |
Chromosome Location : | 8q11.2 |
Pathway : | DNA Repair, organism-specific biosystem; Dual incision reaction in TC-NER, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem; |
Function : | DNA binding; metal ion binding; translation elongation factor activity; zinc ion binding; |
Products Types
◆ Recombinant Protein | ||
TCEA1-9069M | Recombinant Mouse TCEA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TCEA1-5639R | Recombinant Rat TCEA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TCEA1-4461R | Recombinant Rhesus Macaque TCEA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TCEA1-6404H | Recombinant Human TCEA1 Protein (Met1-Met228), N-His tagged | +Inquiry |
TCEA1-5980R | Recombinant Rat TCEA1 Protein | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket