"TCEA3" Related Products

Expand
Expand

Recombinant Human TCEA3

Cat.No.: TCEA3-30320TH
Product Overview: Recombinant full length Human TFIISH with a N terminal proprietary tag; Predicted MWt 64.39 kDa.
Protein length: 348 amino acids
Molecular Weight: 64.390kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MGQEEELLRIAKKLEKMVARKNTEGALDLLKKLHSCQMSI QLLQTTRIGVAVNGVRKHCSDKEVVSLAKVLIKNWKRLLD SPGPPKGEKGEEREKAKKKEKGLECSDWKPEAGLSPPRKK REDPKTRRDSVDSKSSASSSPKRPSVERSNSSKSKAESPK TPSSPLTPTFASSMCLLAPCYLTGDSVRDKCVEMLSAALK ADDDYKDYGVNCDKMASEIEDHIYQELKSTDMKYRNRVRS RISNLKDPRNPGLRRNVLSGAISAGLIAKMTAEEMASDEL RELRNAMTQEAIREHQMAKTGGTTTDLFQCSKCKKKNCTY NQVQTRSADEPMTTFVLCNECGNRWKFC
Sequence Similarities: Belongs to the TFS-II family.Contains 1 TFIIS central domain.Contains 1 TFIIS N-terminal domain.Contains 1 TFIIS-type zinc finger.
Gene Name: TCEA3 transcription elongation factor A (SII), 3 [ Homo sapiens ]
Official Symbol: TCEA3
Synonyms: TCEA3; transcription elongation factor A (SII), 3; transcription elongation factor A protein 3; TFIIS.H;
Gene ID: 6920
mRNA Refseq: NM_003196
Protein Refseq: NP_003187
MIM: 604128
Uniprot ID: O75764
Chromosome Location: 1p36.11
Function: DNA binding; metal ion binding; translation elongation factor activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.