"TLN1" Related Products

Expand
Expand

Recombinant Human TLN1, His-tagged

Cat.No. : TLN1-31442TH
Product Overview : Recombinant fragment, corresponding to amino acids 2072-2532 of Human Talin 1 with N terminal His tag. MWt: 53kDa.
Description : This gene encodes a cytoskeletal protein that is concentrated in areas of cell-substratum and cell-cell contacts. The encoded protein plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. It codistributes with integrins in the cell surface membrane in order to assist in the attachment of adherent cells to extracellular matrices and of lymphocytes to other cells. The N-terminus of this protein contains elements for localization to cell-extracellular matrix junctions. The C-terminus contains binding sites for proteins such as beta-1-integrin, actin, and vinculin.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 82 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EDPETQVVLINAVKDVAKALGDLISATKAAAGKVGDDPAV WQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEAT TEHIRQELAVFCSPEPPAKTSTPEDFIRMTKGITMATA KAVAAGNSCRQEDVIATANLSRRAIADMLRACKEAAYHPE VAPDVRLRALHYGRECANGYLELLDHVLLTLQKPSPEL KQQLTGHSKRVAGSVTELIQAAEAMKGTEWVDPEDPTV IAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLNFEE QILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPA NALDDGQWSQGLISAARMVAAATNNLCEAANAAVQGHA SQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAA GNAVKRASDNLVKAAQKAAAFEEQENETVVVKEKMVGG IAQIIAAQEEMLRKERELEEARKKLAQIRQQQYKF( Amino acid sequence (Sequence determined by 5 Sequencing))
Sequence Similarities : Contains 1 FERM domain.Contains 1 I/LWEQ domain.
Gene Name : TLN1 talin 1 [ Homo sapiens ]
Official Symbol : TLN1
Synonyms : TLN1; talin 1; TLN; talin-1; ILWEQ;
Gene ID : 7094
mRNA Refseq : NM_006289
Protein Refseq : NP_006280
MIM : 186745
Uniprot ID : Q9Y490
Chromosome Location : 9p23-p21
Pathway : Activation of Chaperones by IRE1alpha, organism-specific biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; EGF receptor (ErbB1) signaling pathway, organism-specific biosystem;
Function : LIM domain binding; actin binding; binding; insulin receptor binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.