"TNFRSF1B" Related Products

Expand
Expand
Expand

Recombinant Human TNFRSF1B, Fc-tagged

Cat.No.: TNFRSF1B-31574TH
Product Overview: Recombinant fragment corresponding to amino acids 23-253 of human TNF Receptor II fused to the Fc region of human IgG1 expressed in modified human 293 cells.
Description: The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways.
Conjugation: Fc
Biological activity: The ND50 of TNF Receptor II-Fc Chimera is typically 20-50 ng/ml as measured by its ability to neutralize TNF-a mediated cytoxicity in murine WEHI 164 cells in the presence of actinomycin D.
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin, PBS
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: Theoretical sequence: LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQH AKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRC SSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCA PLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDI CRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHL PQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGIPKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK
Sequence Similarities: Contains 4 TNFR-Cys repeats.
Gene Name: TNFRSF1B tumor necrosis factor receptor superfamily, member 1B [ Homo sapiens ]
Official Symbol: TNFRSF1B
Synonyms: TNFRSF1B; tumor necrosis factor receptor superfamily, member 1B; TNFR2; tumor necrosis factor receptor superfamily member 1B; CD120b; p75; TNF R II; TNF R75; TNFBR; TNFR80;
Gene ID: 7133
mRNA Refseq: NM_001066
Protein Refseq: NP_001057
MIM: 191191
Uniprot ID: P20333
Chromosome Location: 1p36.22
Pathway: Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; Apoptosis, organism-specific biosystem;
Function: protein binding; receptor activity; tumor necrosis factor-activated receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.