"TOR1A" Related Products

Expand
Expand

Recombinant Human TOR1A

Cat.No.: TOR1A-29828TH
Product Overview: Recombinant fragment with deletion at aa 303 , of Human Torsin A with N-Terminal proprietary tag.Mol Wt 62.41 kDa inclusive of tag.
Description: The protein encoded by this gene is a member of the AAA family of adenosine triphosphatases (ATPases), is related to the Clp protease/heat shock family and is expressed prominently in the substantia nigra pars compacta. Mutations in this gene result in the autosomal dominant disorder, torsion dystonia 1.
Protein length: 332 amino acids
Molecular Weight: 62.410kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MKLGRAVLGLLLLAPSVVQAVEPISLGLALAGVLTGYIYP RLYCLFAECCGQKRSLSREALQKDLDDNLFGQHLAKKIIL NAVFGFINNPKPKKPLTLSLHGWTGTGKNFVSKIIAENIY EGGLNSDYVHLFVATLHFPHASNITLYKDQLQLWIRGNVS ACARSIFIFDEMDKMHAGLIDAIKPFLDYYDLVDGVSYQK AMFIFLSNAGAERITDVALDFWRSGKQREDIKLKDIEHAL SVSVFNNKNSGFWHSSLIHRNLIDYFVPFLPLEYKHLKMC IRVEMQSRGYEIDEDIVSRVAEMTFFPKEERVFSDKGCKT VFTKLDYYYDD
Gene Name: TOR1A torsin family 1, member A (torsin A) [ Homo sapiens ]
Official Symbol: TOR1A
Synonyms: TOR1A; torsin family 1, member A (torsin A); dystonia 1, torsion (autosomal dominant; torsin A) , DYT1; torsin-1A; DQ2;
Gene ID: 1861
mRNA Refseq: NM_000113
Protein Refseq: NP_000104
MIM: 605204
Uniprot ID: O14656
Chromosome Location: 9q32-q34
Pathway: Alpha-synuclein signaling, organism-specific biosystem;
Function: ATP binding; nucleotide binding; serine-type endopeptidase activity; unfolded protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.