"TST" Related Products

Expand
Expand
Expand

Recombinant Human TST, His-tagged

Cat.No.: TST-29569TH
Product Overview: Recombinant full length Human TST with N terminal His tag; 317 amino acids with a predicted MWt 35.6 kDa including tag.
Description: The product of this gene is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The gene product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.
Protein length: 297 amino acids
Conjugation: HIS
Molecular Weight: 35.600kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol
Storage: Please see Notes section
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMVHQVLYRALVSTKWLAESI RTGKLGPGLRVLDASWYSPGTREARKEYLERHVPGASFFD IEECRDTASPYEMMLPSEAGFAEYVGRLGISNHTHVVVYD GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHP VTSEPSRPEPAVFKATLDRSLLKTYEQVLENLESKRFQLV DSRSQGRFLGTEPEPDAVGLDSGHIRGAVNMPFMDFLTED GFEKGPEELRALFQTKKVDLSQPLIATCRKGVTACHVALA AYLCGKPDVAVYDGSWSEWFRRAPPESRVSQGKSEKA
Sequence Similarities: Contains 2 rhodanese domains.
Gene Name: TST thiosulfate sulfurtransferase (rhodanese) [ Homo sapiens ]
Official Symbol: TST
Synonyms: TST; thiosulfate sulfurtransferase (rhodanese); thiosulfate sulfurtransferase; RDS;
Gene ID: 7263
mRNA Refseq: NM_003312
Protein Refseq: NP_003303
MIM: 180370
Uniprot ID: Q16762
Chromosome Location: 22q13.1
Pathway: Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Sulfur relay system, organism-specific biosystem; Sulfur relay system, conserved biosystem;
Function: 5S rRNA binding; RNA binding; thiosulfate sulfurtransferase activity; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.