"TTC1" Related Products

Expand
Expand

Recombinant Human TTC1

Cat.No.: TTC1-31246TH
Product Overview: Recombinant full length Human TTC1 produced in Saccharomyces cerevisiae. Amino acids 1-292. Molecular weight is 34 kDa. Protein is tagged with 26 kDa proprietary tag.
Description: Tetratricopeptide repeat protein 1 is a protein that in humans is encoded by the TTC1 gene.
Form: Liquid
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Store at -20oC.
Sequences of amino acids: MGEKSENCGVPEDLLNGLKVTDTQEAECAGPPVPDPKNQH SQSKLLRDDEAHLQEDQGEEECFHDCSASFEEEPGADK VENKSNEDVNSSELDEEYLIELEKNMSDEEKQKRREES TRLKEEGNEQFKKGDYIEAESSYSRALEMCPSCFQKERSI LFSNRAAARMKQDKKEMAINDCSKAIQLNPSYIRAILR RAELYEKTDKLDEALEDYKSILEKDPSIHQAREACMRL PKQIEERNERLKEEMLGKLKDLGNLVLRPFGLSTENFQIKQDSSTGSYSINFVQNPNNNR
Sequence Similarities: Contains 3 TPR repeats.
Gene Name: TTC1 tetratricopeptide repeat domain 1 [ Homo sapiens ]
Official Symbol: TTC1
Synonyms: TTC1; tetratricopeptide repeat domain 1; tetratricopeptide repeat protein 1; TPR1;
Gene ID: 7265
mRNA Refseq: NM_003314
Protein Refseq: NP_003305
MIM: 601963
Uniprot ID: Q99614
Chromosome Location: 5q32-q33.2
Function: protein binding; unfolded protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.