Description : |
Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occuring antisense transcript rTSalpha (GeneID:55556) vary inversely when cell-growth progresses from late-log to plateau phase. |
Conjugation : |
HIS |
Source : |
E. coli |
Form : |
Lyophilised:Reconstitute with 97 μl aqua dest. |
Storage buffer : |
Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : |
Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : |
MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHI LRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKR VFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRD FLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYS GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMA |
Gene ID : |
TYMS thymidylate synthetase [ Homo sapiens ] |
Official Symbol : |
TYMS |
Synonyms : |
TYMS; thymidylate synthetase; TS; thymidylate synthase; HsT422; TMS; Tsase; |