"UBE2S" Related Products

Expand
Expand

Recombinant Human UBE2S, His-tagged

Cat.No.: UBE2S-26459TH
Product Overview: Recombinant fragment, corresponding to amino acids 24-222 of Human E2 EPF with N terminal His tag; Predicted MWt 22 kDa.
Description: This gene encodes a member of the ubiquitin-conjugating enzyme family. The encoded protein is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 86 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: TADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMK LLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKR DWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLE NYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEA SSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL
Sequence Similarities: Belongs to the ubiquitin-conjugating enzyme family.
Gene Name: UBE2S ubiquitin-conjugating enzyme E2S [ Homo sapiens ]
Official Symbol: UBE2S
Synonyms: UBE2S; ubiquitin-conjugating enzyme E2S; ubiquitin-conjugating enzyme E2 S; E2 EPF; ubiquitin carrier protein; ubiquitin conjugating enzyme E2 24 kD; ubiquitin protein ligase;
Gene ID: 27338
mRNA Refseq: NM_014501
Protein Refseq: NP_055316
MIM: 610309
Uniprot ID: Q16763
Chromosome Location: 19q13.43
Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem;
Function: ATP binding; acid-amino acid ligase activity; ligase activity; nucleotide binding; ubiquitin-protein ligase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.