Recombinant Human UPK3A, His-tagged
Cat.No. : | UPK3A-31078TH |
Product Overview : | Recombinant fragment of Human Uroplakin III with an N terminal His tag; 214aa, 23.1kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the uroplakin family, a group of transmembrane proteins that form complexes on the apical surface of the bladder epithelium. Mutations in this gene may be associated with renal adysplasia. Alternatively spliced transcript variants have been described. |
Protein length : | 189 amino acids |
Conjugation : | HIS |
Molecular Weight : | 23.100kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Expressed in ureter. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 20% Glycerol, 0.88% Sodium chloride |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMVNLQPQLASVTFATN NPTLTTVALEKPLCMFDSKEALTGTHEVYLYVLVDSAISR NASVQDSTNTPLGSTFLQTEGGRTGPYKAVAFDLIPCSDL PSLDAIGDVSKASQILNAYLVRVGANGTCLWDPNFQGLCN PPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTP YSTIDTWPGRRSGG |
Sequence Similarities : | Belongs to the uroplakin-3 family. |
Gene Name : | UPK3A uroplakin 3A [ Homo sapiens ] |
Official Symbol : | UPK3A |
Synonyms : | UPK3A; uroplakin 3A; UPK3, uroplakin 3; uroplakin-3a; |
Gene ID : | 7380 |
mRNA Refseq : | NM_001167574 |
Protein Refseq : | NP_001161046 |
MIM : | 611559 |
Uniprot ID : | O75631 |
Chromosome Location : | 22q13.31 |
Products Types
◆ Recombinant Protein | ||
UPK3A-9928M | Recombinant Mouse UPK3A Protein, His (Fc)-Avi-tagged | +Inquiry |
UPK3A-284H | Recombinant Human UPK3A Protein, His-tagged | +Inquiry |
Upk3a-285R | Recombinant Rat Upk3a Protein, His-tagged | +Inquiry |
UPK3A-2498M | Recombinant Mouse UPK3A Protein (19-207 aa), His-Myc-tagged | +Inquiry |
UPK3A-4747H | Recombinant Human Uroplakin 3A, His-tagged | +Inquiry |
◆ Lysates | ||
UPK3A-724HCL | Recombinant Human UPK3A lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket