"UPK3A" Related Products

Expand

Recombinant Human UPK3A, His-tagged

Cat.No.: UPK3A-31078TH
Product Overview: Recombinant fragment of Human Uroplakin III with an N terminal His tag; 214aa, 23.1kDa.
Description: This gene encodes a member of the uroplakin family, a group of transmembrane proteins that form complexes on the apical surface of the bladder epithelium. Mutations in this gene may be associated with renal adysplasia. Alternatively spliced transcript variants have been described.
Protein length: 189 amino acids
Conjugation: HIS
Molecular Weight: 23.100kDa inclusive of tags
Source: E. coli
Tissue specificity: Expressed in ureter.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 20% Glycerol, 0.88% Sodium chloride
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMVNLQPQLASVTFATN NPTLTTVALEKPLCMFDSKEALTGTHEVYLYVLVDSAISR NASVQDSTNTPLGSTFLQTEGGRTGPYKAVAFDLIPCSDL PSLDAIGDVSKASQILNAYLVRVGANGTCLWDPNFQGLCN PPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTP YSTIDTWPGRRSGG
Sequence Similarities: Belongs to the uroplakin-3 family.
Gene Name: UPK3A uroplakin 3A [ Homo sapiens ]
Official Symbol: UPK3A
Synonyms: UPK3A; uroplakin 3A; UPK3, uroplakin 3; uroplakin-3a;
Gene ID: 7380
mRNA Refseq: NM_001167574
Protein Refseq: NP_001161046
MIM: 611559
Uniprot ID: O75631
Chromosome Location: 22q13.31

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.