"WARS" Related Products

Expand
Expand
Expand

Recombinant Human WARS, His-tagged

Cat.No.: WARS-30747TH
Product Overview: Recombinant full length Human Tryptophanyl tRNA synthetase fused to His Tag at N-terminus; 491aa, 55.3kDa.
Description: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene.
Protein length: 471 amino acids
Conjugation: HIS
Molecular Weight: 55.300kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 0.58% Sodium chloride, 10% Glycerol
Storage: Please see Notes section
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPNSEPASLLELFNSIATQG ELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKA DCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDY DKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSH RDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFT KWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAK DIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTF NQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDR TDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFF PALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGG RDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDY TSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEF MTPRKLSFDFQ
Sequence Similarities: Belongs to the class-I aminoacyl-tRNA synthetase family.Contains 1 WHEP-TRS domain.
Gene Name: WARS tryptophanyl-tRNA synthetase [ Homo sapiens ]
Official Symbol: WARS
Synonyms: WARS; tryptophanyl-tRNA synthetase; IFI53; tryptophanyl-tRNA synthetase, cytoplasmic; IFP53; tryptophan tRNA ligase 1; cytoplasmic;
Gene ID: 7453
mRNA Refseq: NM_004184
Protein Refseq: NP_004175
MIM: 191050
Uniprot ID: P23381
Chromosome Location: 14q32.2
Pathway: Aminoacyl-tRNA biosynthesis, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, conserved biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, conserved biosystem; Cytosolic tRNA aminoacylation, organism-specific biosystem;
Function: ATP binding; aminoacyl-tRNA ligase activity; ligase activity; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.