Recombinant Human XRCC6, His-tagged
Cat.No. : | XRCC6-29198TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 334-609 of Human Ku70 with N terminal His tag; 276 amino acids, 36kDa. |
- Specification
- Gene Information
- Related Products
Description : | The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 69 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEES LVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFV ALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEK IMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRN LEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKE LVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTH ISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTK HFQD |
Sequence Similarities : | Belongs to the ku70 family.Contains 1 Ku domain.Contains 1 SAP domain. |
Gene Name : | XRCC6 X-ray repair complementing defective repair in Chinese hamster cells 6 [ Homo sapiens ] |
Official Symbol : | XRCC6 |
Synonyms : | XRCC6; X-ray repair complementing defective repair in Chinese hamster cells 6; G22P1, thyroid autoantigen 70kD (Ku antigen) , thyroid autoantigen 70kDa (Ku antigen); X-ray repair cross-complementing protein 6; D22S671; D22S731; Ku autoantigen; 70kDa; KU |
Gene ID : | 2547 |
mRNA Refseq : | NM_001469 |
Protein Refseq : | NP_001460 |
MIM : | 152690 |
Uniprot ID : | P12956 |
Chromosome Location : | 22q13.2 |
Pathway : | 2-LTR circle formation, organism-specific biosystem; BARD1 signaling events, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; DNA Repair, organism-specific biosystem; DNA-PK complex, organism-specific biosystem; |
Function : | 5-deoxyribose-5-phosphate lyase activity; ATP binding; ATP-dependent DNA helicase activity; DNA binding; double-stranded DNA binding; |
Products Types
◆ Recombinant Protein | ||
XRCC6-2371H | Recombinant Human XRCC6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Xrcc6-7024M | Recombinant Mouse Xrcc6 Protein, Myc/DDK-tagged | +Inquiry |
XRCC6-1204H | Recombinant Human XRCC6 Protein (M1-D609), Flag tagged | +Inquiry |
XRCC6-10244M | Recombinant Mouse XRCC6 Protein, His (Fc)-Avi-tagged | +Inquiry |
XRCC6-1205H | Recombinant Human XRCC6 Protein (M1-D609), His/Strep/Flag tagged | +Inquiry |
◆ Lysates | ||
XRCC6-253HCL | Recombinant Human XRCC6 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket