"ZNF232" Related Products

Recombinant Human ZNF232, His-tagged

Cat.No.: ZNF232-30756TH
Product Overview: Recombinant fragment, corresponding to amino acids 1-296 of Human ZNF232 with N terminal His tag; MWt 34 kDa.
Conjugation: HIS
Source: E. coli
Tissue specificity: Ubiquitous. Higher expression seen in the liver, testis and ovary.
Form: Lyophilised:Reconstitute with 122 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MEPPGPVRGPLQDSSWYEPSAELVQTRMAVSLTAAETLAL QGTQGQEKMMMMGPKEEEQSCEYETRLPGNHSTSQEIF RQRFRHLRYQETPGPREALSQLRVLCCEWLRPEKHTKE QILEFLVLEQFLTILPEELQSWVRGHHPKSGEEAVTVL EDLEKGLEPEPQVPGPAHGPAQEEPWEKKESLGAAQEALS IQLQPKETQPFPKSEQVYLHFLSVVTEDGPEPKDKGSL PQPPITEVESQVFSEKLATDTSTFEATSEGTLELQQRN PKAERLRWSPAQEESFRQMVVIHKEI
Sequence Similarities: Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 5 C2H2-type zinc fingers.Contains 1 SCAN box domain.
Gene Name: ZNF232 zinc finger protein 232 [ Homo sapiens ]
Official Symbol: ZNF232
Synonyms: ZNF232; zinc finger protein 232; ZSCAN11;
Gene ID: 7775
mRNA Refseq: NM_014519
Protein Refseq: NP_055334
Uniprot ID: Q9UNY5
Chromosome Location: 17p13.2
Function: DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.