"ZNF259" Related Products

Expand

Recombinant Human ZNF259, His-tagged

Cat.No.: ZNF259-30759TH
Product Overview: Recombinant fragment, corresponding to amino acids 29-459 of Human ZNF259 with an N terminal His tag; Predicted MWt 50 kDa.
Description: Zinc finger protein ZPR1 is a protein that in humans is encoded by the ZNF259 gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 158 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DHLFRPISAEDEEQQPTEIESLCMNCYCNGMTRLLLTKIP FFREIIVSSFSCEHCGWNNTEIQSAGRIQDQGVRYTLS VRALEDMNREVVKTDSAATRIPELDFEIPAFSQKGALT TVEGLITRAISGLEQDQPARRANKDATAERIDEFIVKL KELKQVASPFTLIIDDPSGNSFVENPHAPQKDDALVITHYNRTRQQEEMLGLQEEAPAEKPEEEDLRNEVLQFSTNCP ECNAPAQTNMKLVQIPHFKEVIIMATNCENCGHRTNEV KSGGAVEPLGTRITLHITDASDMTRDLLKSETCSVEIP ELEFELGMAVLGGKFTTLEGLLKDIRELVTKNPFTLGD SSNPGQTERLQEFSQKMDQIIEGNMKAHFIMDDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGYE AGLAPQR
Gene Name: ZNF259 zinc finger protein 259 [ Homo sapiens ]
Official Symbol: ZNF259
Synonyms: ZNF259; zinc finger protein 259; zinc finger protein ZPR1; ZPR1;
Gene ID: 8882
mRNA Refseq: NM_003904
Protein Refseq: NP_003895
MIM: 603901
Uniprot ID: O75312
Chromosome Location: 11q23.3
Pathway: EGFR1 Signaling Pathway, organism-specific biosystem;
Function: metal ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.