Recombinant Human ZNHIT3, His-tagged
Cat.No. : | ZNHIT3-31722TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 2-155 of Human ZNHIT3 with N terminal His tag; Predicted MWt 18 kDa. |
- Specification
- Gene Information
- Related Products
Description : | ZNHIT3 functions as a transcriptional coactivator and contains 1 HIT type zinc finger. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 86 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQ CNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLN SDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNL DQGEDKAKLMRAYMQEPLFVEFADCCLGIVEPSQNEES |
Gene Name : | ZNHIT3 zinc finger, HIT-type containing 3 [ Homo sapiens ] |
Official Symbol : | ZNHIT3 |
Synonyms : | ZNHIT3; zinc finger, HIT-type containing 3; thyroid hormone receptor interactor 3 , TRIP3, zinc finger, HIT type 3; zinc finger HIT domain-containing protein 3; |
Gene ID : | 9326 |
mRNA Refseq : | NM_004773 |
Protein Refseq : | NP_004764 |
MIM : | 604500 |
Uniprot ID : | Q15649 |
Chromosome Location : | 17q21.1 |
Function : | metal ion binding; thyroid hormone receptor binding; |
Products Types
◆ Recombinant Protein | ||
ZNHIT3-5181R | Recombinant Rhesus Macaque ZNHIT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZNHIT3-10487M | Recombinant Mouse ZNHIT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZNHIT3-2327H | Recombinant Human ZNHIT3, His-tagged | +Inquiry |
ZNHIT3-5368R | Recombinant Rhesus monkey ZNHIT3 Protein, His-tagged | +Inquiry |
ZNHIT3-19215M | Recombinant Mouse ZNHIT3 Protein | +Inquiry |
◆ Lysates | ||
ZNHIT3-9196HCL | Recombinant Human ZNHIT3 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket