"ZSCAN21" Related Products

Recombinant Human ZSCAN21, His-tagged

Cat.No.: ZSCAN21-31654TH
Product Overview: Recombinant fragment, corresponding to amino acids 178-473 of Human ZFP38 with N terminal His tag; MWt 44 kDa ;
Description: Zinc finger and SCAN domain-containing protein 21 is a protein that in humans is encoded by the ZSCAN21 gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 85 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEA EGLKGDIISVIIANKPEASLERQCVNLENEKGTKPPLQ EAGSKKGRESVPTKPTPGERRYICAECGKAFSNSSNLT KHRRTHTGEKPYVCTKCGKAFSHSSNLTLHYRTHLVDR PYDCKCGKAFGQSSDLLKHQRMHTEEAPYQCKDCGKAFSG KGSLIRHYRIHTGEKPYQCNECGKSFSQHAGLSSHQRL HTGEKPYKCKECGKAFNHSSNFNKHHRIHTGEKPYWCH HCGKTFCSKSNLSKHQRVHTGEGEAP
Gene Name: ZSCAN21 zinc finger and SCAN domain containing 21 [ Homo sapiens ]
Official Symbol: ZSCAN21
Synonyms: ZSCAN21; zinc finger and SCAN domain containing 21; zinc finger protein 38 , zinc finger protein 38 (KOX 25) , ZNF38; zinc finger and SCAN domain-containing protein 21; DKFZp434L134; NY REN 21; Zipro1;
Gene ID: 7589
mRNA Refseq: NM_145914
Protein Refseq: NP_666019
MIM: 601261
Uniprot ID: Q9Y5A6
Chromosome Location: 7q11.1
Function: DNA binding; metal ion binding; protein binding; sequence-specific DNA binding transcription factor activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.