"GHR" Related Products

Recombinant Rabbit GHR Protein

Cat.No.: GHR-1836R
Product Overview: Recombinant Rabbit GHR extracellular portion was expressed in E. coli.
Source: E. coli
Species: Rabbit
Form: Lyophilized from a concentrated (1mg/ml) solution with 0.0045 mM NaHCO3.
Bio-activity: Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones.
Molecular Mass: 28 kDa
AA Sequence: AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP
Purity: > 98.0% as determined by SDS-PAGE
Storage: Lyophilized Growth Hormone Binding Protein Rabbit although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution GHBP Rabbit should be stored at 4 centigrade between 2-7 days and for future use below
Reconstitution: It is recommended to reconstitute the lyophilized GHBP Rabbit in sterile 0.4% NaHCO3 pH 10, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Gene Name: GHR growth hormone receptor [ Oryctolagus cuniculus ]
Official Symbol: GHR
Synonyms: GHR; growth hormone receptor; GH receptor; somatotropin receptor
Gene ID: 100009325
mRNA Refseq: NM_001082636
Protein Refseq: NP_001076105
UniProt ID: P19941

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.