"GHR" Related Products

Expand
Expand
Expand

Recombinant Rabbit GHR Protein

Cat.No.: GHR-1836R
Product Overview: Recombinant Rabbit GHR extracellular portion was expressed in E. coli.
Source: E. coli
Species: Rabbit
Form: Lyophilized from a concentrated (1mg/ml) solution with 0.0045 mM NaHCO3.
Bio-activity: Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones.
Molecular Mass: 28 kDa
AA Sequence: AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP
Purity: > 98.0% as determined by SDS-PAGE
Storage: Lyophilized Growth Hormone Binding Protein Rabbit although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution GHBP Rabbit should be stored at 4 centigrade between 2-7 days and for future use below
Reconstitution: It is recommended to reconstitute the lyophilized GHBP Rabbit in sterile 0.4% NaHCO3 pH 10, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Gene Name: GHR growth hormone receptor [ Oryctolagus cuniculus ]
Official Symbol: GHR
Synonyms: GHR; growth hormone receptor; GH receptor; somatotropin receptor
Gene ID: 100009325
mRNA Refseq: NM_001082636
Protein Refseq: NP_001076105
UniProt ID: P19941

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.