"GHR" Related Products

Expand
Expand
Expand

Recombinant Rabbit GHR Protein

Cat.No. : GHR-1836R
Product Overview : Recombinant Rabbit GHR extracellular portion was expressed in E. coli.
Source : E. coli
Species : Rabbit
Form : Lyophilized from a concentrated (1mg/ml) solution with 0.0045 mM NaHCO3.
Bio-activity : Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones.
Molecular Mass : 28 kDa
AA Sequence : AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP
Purity : > 98.0% as determined by SDS-PAGE
Storage : Lyophilized Growth Hormone Binding Protein Rabbit although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution GHBP Rabbit should be stored at 4 centigrade between 2-7 days and for future use below
Reconstitution : It is recommended to reconstitute the lyophilized GHBP Rabbit in sterile 0.4% NaHCO3 pH 10, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Gene Name : GHR growth hormone receptor [ Oryctolagus cuniculus ]
Official Symbol : GHR
Synonyms : GHR; growth hormone receptor; GH receptor; somatotropin receptor
Gene ID : 100009325
mRNA Refseq : NM_001082636
Protein Refseq : NP_001076105
UniProt ID : P19941

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.