"PDIA3" Related Products

Expand

Recombinant Human Protein Disulfide Isomerase, His-tagged

Cat. No.: PDIA3-1841H
Product Overview: Recombinant human PDIA3 protein fused to His-tag at N-terminus was expressed inE.coliand purified by using conventional chromatography techniques. MW = 58.5 kDa (518aa).
Description: PDIA3, also known as protein disulfide-isomerase A3, is a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. This protein has protein disulfide isomerase activity. PDIA3 is also part of the major histocompatibility complex (MHC) class I peptide-loading complex (TAP1), which is essential for formation of the final antigen conformation and export from the endoplasmic reticulum to the cell surface.
Source: E.coli.
Form: Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 1mM DTT, 0.1 M NaCl, and 10% glycerol.
Purity: > 95% by SDS – PAGE.
Concentration: 1 mg/ml (determined by Bradford assay).
Sequences Of Amino Acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMSDV LELTDDNFES RISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTA NTNTCN KYGV SGYPTLKIFR DGEEAGAYDG PRTADGIVSH LKKQAGPASV PLRTEEEFKK FISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGE GIIL FRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLI AY YDV DYEKNAKGSN YWRNRVMMVA KKFLDAGHKL NFAVASRKTF SHELSDFGLE STAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKS EPIPESN DGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDP NIVI AKMDATANDVPSPYEVRGFPTIYFSP ANKKLNPKKY EGGRELSDFI SYLQREATNP PVIQEEKPKK KKKAQEDL.
Storage: can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Gene Name: PDIA3 protein disulfide isomerase family A, member 3 [ Homo sapiens ]
Synonyms: protein disulfide isomerase family A, member 3; P58; ER60; ERp57; ERp60; ERp61; GRP57; GRP58; PI-PLC; HsT17083; EC 5.3.4.1; PDIA3_HUMAN;58 kDa glucose-regulated protein; 58 kDa microsomal protein; Disulfide isomerase ER-60; Protein disulfide-isomerase A3 precursor; endoplasmic reticulum P58; glucose regulated protein, 58kDa; phospholipase C-alpha; protein disulfide isomerase-associated 3; PDIA3
Gene ID: 2923
mRNA Refseq: NM_005313
Protein Refseq: NP_005304
MIM: 602046
UniProt ID: P30101
Chromosome Location: 15q15
Pathway: Antigen processing and presentation
Function: cysteine-type endopeptidase activity; isomerase activity; phospholipase C activity; protein binding; protein disulfide isomerase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.