Recombinant Human MBD3, His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0003
Product Name:  Recombinant Human MBD3, His-tagged
Product Overview:  Recombinant fragment, corresponding to amino acids 164-291 of Human MBD3 with N terminal His tag; Predicted MWt 15 kDa.
Description:  DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). However, unlike the other family members, MBD3 is not capable of binding to methylated DNA. The predicted MBD3 protein shares 71% and 94% identity with MBD2 (isoform 1) and mouse Mbd3.MBD3 is a subunit of the NuRD, a multisubunit complex containing nucleosome remodeling and histone deacetylase activities. MBD3 mediates the association of metastasis-associated protein 2 (MTA2) with the core histone deacetylase complex.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Species:  Human
Formulation:  Lyophilised:Reconstitute with 86 μl aqua dest.
Tag:  His
Amino Acid Sequence:  GLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKN PGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEE ALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEE EEPDPDPEMEHV
Sequence Similarities:  Contains 1 MBD (methyl-CpG-binding) domain.
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  MBD3 methyl-CpG binding domain protein 3 [ Homo sapiens ]
Gene ID NCBI:  53615
Official Symbol:  MBD3
Synonyms:  MBD3; methyl-CpG binding domain protein 3; methyl-CpG-binding domain protein 3;
mRNA Refseq:  NM_003926
Protein Refseq:  NP_003917
MIM:  603573
UniProt ID:  O95983
Chromosome Location:  19p13
Function:  DNA binding; chromatin binding; protein binding;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.