"TGFB1" Related Products

Expand
Expand

Recombinant Cattle TGFB1 Protein, His-tagged

Cat.No.: TGFB1-1385C
Product Overview: Recombinant Cattle TGFB1 Protein (279-390aa) was expressed in E. coli with N-terminal His tag.
Source: E. coli
Species: Cattle
Tag : His
Form: Tris-based buffer, 50% glycerol.
Molecular Mass: 16.8 kDa
AA Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNP
GASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name: TGFB1 transforming growth factor beta 1 [ Bos taurus (cattle) ]
Official Symbol: TGFB1
Synonyms: transforming growth factor beta-1; TGFB1
Gene ID: 282089
mRNA Refseq: NM_001166068.1
Protein Refseq: NP_001159540.1
UniProt ID: P18341

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.