"ATP1A1" Related Products

Expand

Recombinant Human ATP1A1 protein

Cat.No.: ATP1A1-102H
Product Overview: Recombinant DNA fragment which encoded for two peptide AG-10 (NRWHSIYITRFG) and AG-32 (TWYKIAFQRNRK) was fully synthesized and fusion to human vitronectin (63-398aa) C-terminal with flexible linker domain (GGGGSGGGGS) for generating VNT-AG10+32 fusion pro
Description: Human CD49f (Integrin a6) has been demonstrated to be specific membrane protein marker for human hematopoietic stem cell (HSC). Two peptide AG-10 (NRWHSIYITRFG) and AG-32 (TWYKIAFQRNRK), which derived from human laminin-111, has been reported to engage with the α6β1 integrin very specifically. To generate a synthetic matrix protein for coating to maintain HSC culture in vitro, AG-10 and AG-32 peptide was fused to human Vitronectin (VNT) C-terminal as recombinant protein. This recombinant VNT-AG10+32 fusion protein may be served as synthetic matrix protein for interaction with α6β1 integrin positive cells.
Source: E. coli
Species: Human
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKS KCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK VNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRT VNRKSTDSPVECMGQEKGEFRE
Purity: >90% by SDS-PAGE
Applications: May be used for in vitro integrain alpha 6 receptor mediated cell differentiation, such as HSC or ES cells regulations, study by using VNT-AG10+32 fusion protein as coating matrix in cell culture.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: ATP1A1 ATPase, Na+/K+ transporting, alpha 1 polypeptide [ Homo sapiens ]
Official Symbol: ATP1A1
Synonyms: ATP1A1; ATPase, Na+/K+ transporting, alpha 1 polypeptide; sodium/potassium-transporting ATPase subunit alpha-1; sodium pump 1; Na+/K+ ATPase 1; Na,K-ATPase alpha-1 subunit; sodium pump subunit alpha-1; Na+, K+ ATPase alpha subunit; Na(+)/K(+) ATPase alpha
Gene ID: 476
mRNA Refseq: NM_000701
Protein Refseq: NP_000692
MIM: 182310
UniProt ID: P05023
Chromosome Location: 1p13
Pathway: Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Carbohydrate digestion and absorption, organism-specific biosystem
Function: 4-nitrophenylphosphatase activity; ATP binding; ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism; hydrolase activity; hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances; meta

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.