Recombinant Human CXCL1 Protein, GST-tagged CXCL1-2155H

Cat.No.:	CXCL1-2155H
Product Overview:	Human CXCL1 full-length ORF ( AAH11976, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal.
Description:	This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression of this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4. [provided by RefSeq, Sep 2014]
Source:	Wheat Germ
Species:	Human
Tag :	GST
Molecular Mass:	37.51 kDa
AA Sequence:	MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Applications:	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes:	Best use within three months from the date of receipt of this protein.
Storage:	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Download Datasheet

Gene Name:	CXCL1 chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) [ Homo sapiens ]
Official Symbol:	CXCL1
Synonyms:	CXCL1; chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha); fibroblast secretory protein , FSP, GRO1, GRO1 oncogene (melanoma growth stimulating activity, alpha) , MGSA; growth-regulated alpha protein; GROa; MGSA a; NAP 3; SCYB1; MGSA alpha; GRO-alpha(1-73); C-X-C motif chemokine 1; fibroblast secretory protein; neutrophil-activating protein 3; melanoma growth stimulatory activity alpha; GRO1 oncogene (melanoma growth-stimulating activity); GRO1 oncogene (melanoma growth stimulating activity, alpha); FSP; GRO1; MGSA; NAP-3; MGSA-a;
Gene ID:	2919
mRNA Refseq:	NM_001511
Protein Refseq:	NP_001502
MIM:	155730
UniProt ID:	P09341