Cat.No. :	CXCL14-2163H
Product Overview :	Human CXCL14 full-length ORF ( AAH03513, 1 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal.
Description :	This antimicrobial gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation. [provided by RefSeq, Sep 2014]
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	37.95 kDa
AA Sequence :	MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing: :	12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name :	CXCL14 chemokine (C-X-C motif) ligand 14 [ Homo sapiens ]
Official Symbol :	CXCL14
Synonyms :	CXCL14; chemokine (C-X-C motif) ligand 14; SCYB14, small inducible cytokine subfamily B (Cys X Cys), member 14 (BRAK); C-X-C motif chemokine 14; BMAC; bolekine; BRAK; breast and kidney; Kec; KS1; MIP 2g; NJAC; MIP-2 gamma; chemokine BRAK; tumor-suppressing chemokine; small-inducible cytokine B14; CXC chemokine in breast and kidney; small inducible cytokine subfamily B (Cys-X-Cys), member 14 (BRAK); KEC; MIP2G; MIP-2g; SCYB14; MGC10687;
Gene ID :	9547
mRNA Refseq :	NM_004887
Protein Refseq :	NP_004878
MIM :	604186
UniProt ID :	O95715

Online Inquiry