"CXCL16" Related Products

Expand
Expand
Expand

Recombinant Human CXCL16 Protein, GST-tagged

Cat.No.: CXCL16-2164H
Product Overview: Human CXCL16 full-length ORF ( AAH17588, 49 a.a. - 273 a.a.) recombinant protein with GST-tag at N-terminal.
Description: CXCL16 (C-X-C Motif Chemokine Ligand 16) is a Protein Coding gene. Diseases associated with CXCL16 include Xanthogranulomatous Cholecystitis. Among its related pathways arePeptide ligand-binding receptors and Chemokine Superfamily Pathway: Human/Mouse Ligand-Receptor Interactions. GO annotations related to this gene include chemokine activity andlow-density lipoprotein receptor activity.
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 50.49 kDa
AA Sequence: NEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPVAPDSNT
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: CXCL16 chemokine (C-X-C motif) ligand 16 [ Homo sapiens ]
Official Symbol: CXCL16
Synonyms: CXCL16; chemokine (C-X-C motif) ligand 16; C-X-C motif chemokine 16; CXC chemokine ligand 16; CXCLG16; SR PSOX; SRPSOX; small-inducible cytokine B16; transmembrane chemokine CXCL16; scavenger receptor for phosphatidylserine and oxidized low density lipoprotein; SR-PSOX;
Gene ID: 58191
mRNA Refseq: NM_001100812
Protein Refseq: NP_001094282
MIM: 605398
UniProt ID: Q9H2A7

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.