"CXCL3" Related Products

Expand
Expand
Expand

Recombinant Human CXCL3 Protein, GST-tagged

Cat.No. : CXCL3-2171H
Product Overview : Human CXCL3 full-length ORF ( NP_002081.2, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. [provided by RefSeq, Sep 2014]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 37.7 kDa
AA Sequence : MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing: :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : CXCL3 chemokine (C-X-C motif) ligand 3 [ Homo sapiens ]
Official Symbol : CXCL3
Synonyms : CXCL3; chemokine (C-X-C motif) ligand 3; GRO3, GRO3 oncogene; C-X-C motif chemokine 3; CINC 2b; GROg; MIP 2b; SCYB3; GRO-gamma; MIP2-beta; MGSA gamma; GRO3 oncogene; GRO-gamma(1-73); growth-regulated protein gamma; macrophage inflammatory protein 2-beta; melanoma growth stimulatory activity gamma; GRO3; MIP2B; MIP-2b; CINC-2b;
Gene ID : 2921
mRNA Refseq : NM_002090
Protein Refseq : NP_002081
MIM : 139111
UniProt ID : P19876

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.