"CXCL5" Related Products

Expand
Expand
Expand

Recombinant Human CXCL5 Protein, GST-tagged

Cat.No. : CXCL5-2172H
Product Overview : Human CXCL5 full-length ORF ( AAH08376, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils, to promote angiogenesis and to remodel connective tissues. This protein is thought to play a role in cancer cell proliferation, migration, and invasion. [provided by RefSeq, May 2013]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 38.28 kDa
AA Sequence : MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLRKVIQKILDGGNKEN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing: :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : CXCL5 chemokine (C-X-C motif) ligand 5 [ Homo sapiens ]
Official Symbol : CXCL5
Synonyms : CXCL5; chemokine (C-X-C motif) ligand 5; SCYB5, small inducible cytokine subfamily B (Cys X Cys), member 5 (epithelial derived neutrophil activating peptide 78); C-X-C motif chemokine 5; ENA 78; ENA-78(1-78); small inducible cytokine B5; small-inducible cytokine B5; neutrophil-activating protein 78; neutrophil-activating peptide ENA-78; epithelial-derived neutrophil activating protein 78; epithelial-derived neutrophil-activating peptide 78; epithelial-derived neutrophil-activating protein 78; small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-derived neutrophil-activating peptide 78); SCYB5; ENA-78;
Gene ID : 6374
mRNA Refseq : NM_002994
Protein Refseq : NP_002985
MIM : 600324
UniProt ID : P42830

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.