Recombinant Human CXCL6
| Cat.No. : | CXCL6-27781TH |
| Product Overview : | Highly pure (>98%) recombinant human GCP2. |
- Specification
- Gene Information
- Related Products
| Description : | Chemokine (C-X-C motif) ligand 6 (CXCL6) is a small cytokine belonging to the CXC chemokine family that is also known as granulocyte chemotactic protein 2 (GCP-2). As its former name suggests, CXCL6 is a chemoattractant for neutrophilic granulocytes. |
| Source : | E. coli |
| Form : | Lyophilised |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | Human GCP-2 is an 8.0 kDa protein containing 73 amino acid residues:VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNG KQVCLDPEAPFLKKVIQKILDSGNKKN |
| Sequence Similarities : | Belongs to the intercrine alpha (chemokine CxC) family. |
| Gene Name : | CXCL6 chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2) [ Homo sapiens ] |
| Official Symbol : | CXCL6 |
| Synonyms : | CXCL6; chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2); SCYB6, small inducible cytokine subfamily B (Cys X Cys), member 6 (granulocyte chemotactic protein 2); C-X-C motif chemokine 6; CKA 3; GCP 2; |
| Gene ID : | 6372 |
| mRNA Refseq : | NM_002993 |
| Protein Refseq : | NP_002984 |
| MIM : | 138965 |
| Uniprot ID : | P80162 |
| Chromosome Location : | 4q13.3 |
| Pathway : | Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; |
| Function : | chemokine activity; heparin binding; |
Products Types
| ◆ Recombinant Protein | ||
| CXCL6-2173H | Recombinant Human CXCL6 Protein, GST-tagged | +Inquiry |
| CXCL6-282C | Active Recombinant Human CXCL6 Protein (72 aa) | +Inquiry |
| CXCL6-270H | Active Recombinant Human CXCL6 Protein (Val40-Asn114), N-His tagged, Animal-free, Carrier-free | +Inquiry |
| CXCL6-133H | Active Recombinant Human CXCL6, HIgG1 Fc-tagged, mutant | +Inquiry |
| CXCL6-2190H | Recombinant Human CXCL6 Protein (Val40-Asn114), GST tagged | +Inquiry |
| ◆ Lysates | ||
| CXCL6-7166HCL | Recombinant Human CXCL6 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Ask a Question for All CXCL6 Products
Required fields are marked with *
My Review for All CXCL6 Products
Required fields are marked with *
0
Inquiry Basket
