"EDAR" Related Products

Expand
Expand
Expand

Recombinant Human EDAR Protein, His/Flag/StrepII-tagged

Cat.No. : EDAR-3047H
Product Overview : Purified EDAR (AAH93872.1, 27 a.a. - 183 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Description : This gene encodes a member of the tumor necrosis factor receptor family. The encoded transmembrane protein is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in this gene result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia. [provided by RefSeq, Jul 2008]
Source : Human cells
Species : Human
Tag : His/Flag/StrepII
Form : Liquid
Bio-activity : Not Tested
Molecular Mass : 22.55 kDa
AA Sequence : EYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSCGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKELSGQGH
Applications : Western Blot
Enzyme-linked Immunoabsorbent Assay
SDS-PAGE
Protein Interaction
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration : ≥ 10 μg/mL
Storage Buffer : 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Quality Control Testing :

Western Blot

SDS-PAGE Gel

Gene Name : EDAR ectodysplasin A receptor [ Homo sapiens ]
Official Symbol : EDAR
Synonyms : EDAR; ectodysplasin A receptor; DL, ectodysplasin 1, anhidrotic receptor , ED3; tumor necrosis factor receptor superfamily member EDAR; ED1R; ED5; EDA1R; EDA3; Edar; EDA-A1 receptor; downless homolog; ectodysplasin-A receptor; downless, mouse, homolog of; ectodermal dysplasia receptor; anhidrotic ectodysplasin receptor 1; ectodysplasin 1, anhidrotic receptor; DL; ED3; HRM1; EDA-A1R; FLJ94390;
Gene ID : 10913
mRNA Refseq : NM_022336
Protein Refseq : NP_071731
MIM : 604095
UniProt ID : Q9UNE0

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.