"MTA1" Related Products

Expand
Expand

Recombinant Human MTA1 protein, GST-tagged

Cat.No.: MTA1-35H
Product Overview: Recombinant Human MTA1(542 a.a. - 632 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 35.75 kDa
AA Sequence: ETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGLANHGQTRHMGPSRNLLLNGKSYPTKV
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: MTA1 metastasis associated 1 [ Homo sapiens ]
Official Symbol: MTA1
Synonyms: MTA1; metastasis associated 1; metastasis-associated protein MTA1; metastasis associated gene 1 protein;
Gene ID: 9112
mRNA Refseq: NM_001203258
Protein Refseq: NP_001190187
MIM: 603526
UniProt ID: Q13330

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.