"PCDH12" Related Products

Expand

Recombinant Human PCDH12 protein, T7/His-tagged

Cat.No.: PCDH12-48H
Product Overview: Recombinant human PCDH12 cDNA (25–718aa, derived from BC042634) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFQEVTTLTVKYQVSEEVPSGTVIGKLSQELGREERRRQAGAAFQVLQ LPQALPIQVDSEEGLLSTGRRLDREQLCRQWDPCLVSFDVLATGDLALIHVEIQVLDINDHQPRFPKGEQELEIS ESASLRTRIPLDRALDPDTGPNTLHTYTLSPSEHFALDVIVGPDETKHAELIVVKELDREIHSFFDLVLTAYDNG NPPKSGTSLVKVNVLDSNDNSPAFAESSLALEIQEDAAPGTLLIKLTATDPDQGPNGEVEFFLSKHMPPEVLDTF SIDAKTGQVILRRPLDYEKNPAYEVDVQARDLGPNPIPAHCKVLIKVLDVNDNIPSIHVTWASQPSLVSEALPKD SFIALVMADDLDSGNNGLVHCWLSQELGHFRLKRTNGNTYMLLTNATLDREQWPKYTLTLLAQDQGLQPLSAKKQ LSIQISDINDNAPVFEKSRYEVSTRENNLPSLHLITIKAHDADLGINGKVSYRIQDSPVAHLVAIDSNTGEVTAQ RSLNYEEMAGFEFQVIAEDSGQPMLASSVSVWVSLLDANDNAPEVVQPVLSDGKASLSVLVNASTGHLLVPIETP NGLGPAGTDTPPLATHSSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVTNASSLIGSE WELEIVVEDQGSPPLQTRALLRVMFVTSVDHLRDSARKPGALSMSMLT
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro PCDH12 mediated neuronal cell / placenta differentiation regulation study with this protein as either coating matrix protein or soluble factor.2. May be used as PCDH12 protein-protein interaction assay.3. Potential diagnostic biomarker protein for pre-eclampsia.4. As antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: PCDH12 protocadherin 12 [ Homo sapiens ]
Official Symbol: PCDH12
Synonyms: PCDH12; protocadherin 12; protocadherin-12; VE cadherin 2; VE-cad-2; VE-cadherin 2; vascular cadherin-2; vascular endothelial cadherin 2; vascular endothelial cadherin-2; VECAD2; VE-cadherin-2;
Gene ID: 51294
mRNA Refseq: NM_016580
Protein Refseq: NP_057664
MIM: 605622
UniProt ID: Q9NPG4
Chromosome Location: 5q31.3
Function: calcium ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.