"TACSTD2" Related Products

Expand
Expand
Expand

Recombinant Human TACSTD2 protein, T7/His-tagged

Cat.No.: TACSTD2-81H
Product Overview: Recombinant human TACSTD2 cDNA (27 – 274 aa, derived from BC009409) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSK CLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDE LVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDA AYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro TACSTD2 protein mediated calcium related signal pathway for cancer cell growth regulation study with this protein as either coating matrix protein or soluble factor.2. May be used as TACSTD2 protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: TACSTD2 tumor-associated calcium signal transducer 2 [ Homo sapiens ]
Official Symbol: TACSTD2
Synonyms: TACSTD2; tumor-associated calcium signal transducer 2; M1S1; EGP 1; GA733 1; TROP2; epithelial glycoprotein-1; cell surface glycoprotein TROP2; cell surface glycoprotein Trop-2; pancreatic carcinoma marker protein GA7331; pancreatic carcinoma marker prote
Gene ID: 4070
mRNA Refseq: NM_002353
Protein Refseq: NP_002344
MIM: 137290
UniProt ID: P09758
Chromosome Location: 1p32
Function: receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.