"VEGFA" Related Products

Recombinant Human VEGFA protein

Cat.No.: VEGFA-86H
Product Overview: Recombinant Human VEGFA(Ala 27 - Arg 191) was expressed in HEK293.
Description: VEGF165 is the most abundant splice variant of VEGF-A. VEGF165 is produced by a number of cells including endothelial cells, macrophages and T cells. VEGF165 is involved in angiogenesis, vascular endothelial cell survival, growth, migration and vascular permeability. VEGF gene expression is induced by hypoxia, inflammatory cytokines and oncogenes. VEGF165 binds to heparan sulfate and is retained on the cell surface and in the extracellular matrix. VEGF165 binds to the receptor tyrosine kinases, VEGFR1 and VEGFR2. VEGF165 is the only splice variant that binds to co-receptors NRP-1 and NRP-2 that function to enhance VEGFR2 signaling. Binding of VEGF165 to VEGFR1 and VEGFR2 leads to activation of the PI3K/AKT, p38 MAPK, FAK and paxillin. VEGF plays a key role in tumor angiogenesis in many cancers.
Source: HEK293
Species: Human
Predicted N Terminal: Ala 27
Form: Lyophilized from 0.22 μm filtered solution in PBS, pH7.4. Normally Trehalose is added as protectant before lyophilization.
Molecular Mass: Has a calculated MW of 19 kDa (monomer). As a result of glycosylation, the reducing (R) protein migrates as 24 kDa (monomer), and the non-reducing (NR) protein migrates as 43-50 kDa (homodimer) in SDS-PAGE .
AA Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESN ITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQ LELNERTCRCDKPRR
Endotoxin: Less than 1.0 EU per μg of the Human VEGF165 by the LAL method.
Purity: >98% as determined by SDS-PAGE.>95% as determined by SEC-HPLC.
Storage: Avoid repeated freeze-thaw cycles.No activity loss was observed after storage at:In lyophilized state for 1 year (4 centigrade); After reconstitution under sterile conditions for 3 months (-70 centigrade).
Gene Name: VEGFA vascular endothelial growth factor A [ Homo sapiens ]
Official Symbol: VEGFA
Synonyms: VEGFA; vascular endothelial growth factor A; vascular endothelial growth factor , VEGF; VEGF A; VPF; vascular permeability factor; VEGF; MVCD1; MGC70609;
Gene ID: 7422
mRNA Refseq: NM_001171626
Protein Refseq: NP_001165097
MIM:
UniProt ID: P15692
Chromosome Location: 6p12
Pathway: Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endochondral Ossification, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem;
Function: cell surface binding; chemoattractant activity; cytokine activity; cytokine activity; extracellular matrix binding; fibronectin binding; growth factor activity; growth factor activity; heparin binding; heparin binding; platelet-derived growth factor receptor binding; protein binding; protein heterodimerization activity; protein homodimerization activity; receptor agonist activity

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.