"YARS" Related Products

Expand
Expand

Recombinant Human YARS protein, T7/His-tagged

Cat.No.: YARS-222H
Product Overview: Recombinant human YARS N-terminal fragment (Mini-TyrRA) cDNA (2 – 364 aa, derived from BC016689) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGK PHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTD YQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEK YLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLK SEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQ KPMAKGPAKNSEPEEVI
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro Mini-YARS protein mediated interleukine-8 like activities regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for Mini-YARS protein – protein interaction assay.3. As Enzymatic substrate for various proteases.4. May be used for specific antibody production.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: YARS tyrosyl-tRNA synthetase [ Homo sapiens ]
Official Symbol: YARS
Synonyms: YARS; tyrosyl-tRNA synthetase; tyrosine--tRNA ligase, cytoplasmic; tyrosine tRNA ligase 1; cytoplasmic; tyrRS; YRS; YTS; tyrosyl--tRNA ligase; tyrosine tRNA ligase 1, cytoplasmic; tyrosyl-tRNA synthetase, cytoplasmic; TYRRS; CMTDIC;
Gene ID: 8565
mRNA Refseq: NM_003680
Protein Refseq: NP_003671
MIM: 603623
UniProt ID: P54577
Chromosome Location: 1p35.1
Pathway: Aminoacyl-tRNA biosynthesis, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, conserved biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, conserved biosystem; Cytosolic tRNA aminoacylation, organism-specific biosystem; Gene Expression, organism-specific biosystem; tRNA Aminoacylation, organism-specific biosystem;
Function: ATP binding; interleukin-8 receptor binding; ligase activity; nucleotide binding; signal transducer activity; tRNA binding; tyrosine-tRNA ligase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.