"IL12" Related Products

Expand
Expand

Recombinant Rat IL12 protein, His-tagged

Cat.No.: IL12-27R
Product Overview: Recombinant Rat Interleukin-12 is expressed in CHO cells and the target gene encoding Met23-Ser335(p40)&Arg23-Ser215(p35) is expressed with a 6His tag at the C-terminus.
Description: Interleukin-12 (IL-12), also known as NKSF, TCMF, CLMF and TSF, is a heterodimeric cytokine composed of p35 and p40 subunits. It is produced by monocytes, macrophages, B cells and dendritic cells in response to bacterial lipopolysaccharides and intracellular pathogens. IL-12 signals through the IL-12 receptor complex, which is comprised of IL-12 Rβ1 and IL-12 Rβ2. IL-12 induces the proliferation and activation of hematopoietic stem cells, natural killer cells and T- cells. It is indispensible during the development of Th1 cells, leading to the production of IFN-gamma and IL-2.
Source: CHO
Species: Rat
Tag : His
Form: Lyophilized after extensive dialysis against PBS.
Bio-activity: ED50< 0.1ng/ml, measured in a cell proliferation assay using 2D6 cells.
Molecular Mass: 26-28kDa (p35) and 42-45 kDa (p40), observed by reducing SDS-PAGE.
AA Sequence: p35:RVIPVSGPAKCLNQSQNLLKTTDDMVRTAREKLKHYSCTAGDIDHEDITRDKTSTLEACLPLELHKNESCLATKETSSIIRGSCLPPQKTSLMMTLCLGSIYEDLKMYQSEFQAINAALQSHNHQQITLDRNMLMAIDELMRSLNHSGETLHQKAPMGEADPYRVKMKLCILLHAFSTRVMTINRVMNYLSSSHHHHHH
p40: MWELEKDVYV VEVDWRPDAP GETVTLTCDS PEEDDITWTS DQRRGVIGSG KTLTITVREF LDAGQYTCHR GGETLSHSHL LLHKKENGIW STEILKNFKNKTFLKCEAPN YSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGRASLSAEKVTLNQRDYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQVKPLKNSQVEVS WEYPDSWSTPHSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTSAEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRS
Endotoxin: <0.2 EU/μg, determined by LAL method.
Purity: > 95% as analyzed by SDS-PAGE.
Storage: Lyophilized recombinant rat Interleukin-12 (IL-12), His remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rat Interleukin-12 (IL-12), His should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.
Gene Name: interleukin 12A [ Rattus norvegicus ]
Official Symbol: IL12A
Synonyms: Interleukin-12; IL-12; IL12A
Gene ID: 84405
mRNA Refseq: NM_053390.1
Protein Refseq: NP_445842.1
UniProt ID: Q9R103

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.