"TCF7" Related Products

Expand
Expand

Recombinent Human TCF7 Protein, GST-tagged

Cat.No.: TCF7-15H
Product Overview: Human TCF7 full-length ORF ( NP_003193.2, 1 a.a. - 384 a.a.) recombinant protein with GST-tag at N-terminal.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 68 kDa
AA Sequence: MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESEGAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLPMTVL
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Name: TCF7 transcription factor 7 (T-cell specific, HMG-box) [ Homo sapiens ]
Official Symbol: TCF7
Synonyms: TCF7; transcription factor 7 (T-cell specific, HMG-box); transcription factor 7; TCF 1; T-cell-specific transcription factor 1; TCF-1; FLJ36364; MGC47735;
Gene ID: 6932
mRNA Refseq: NM_001134851
Protein Refseq: NP_001128323
MIM: 189908
UniProt ID: P36402

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.