Recombinant analog of the human hormone leptin


  • Specification
  • Drug Information
  • Related Products
Cat#:  THP-0134
Product Name:  Recombinant analog of the human hormone leptin
Description:  The product, a recombinant analog of the human hormone leptin. The product is produced in E. coli and differs from native human leptin by the addition of a methionine residue at its amino terminus.
Formula:  C714H1167N191O221S6
Sequences:  MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Species:  Human
Source:  E. coli
CAS No. :  186018-45-1
Molecular Weight:  16155.4429 Da
Synonyms:  Metreleptin; Metreleptina; Métréleptine; Metreleptinum; N-Methionylleptin; r-metHuLeptin
Drug name:  Metreleptin
Applications:  The product is indicated as an adjunct to diet as replacement therapy to treat the complications of leptin deficiency in patients with congenital or acquired generalized lipodystrophy.
Examples of Clinical Use:  Congenital or acquired generalized lipodystrophy
Pharmacodynamics :  In patients with leptin deficiency, clinical trials demonstrated that exogenous leptin administration results in weight loss, reduction in mean HbA1c and fasting glucose levels, reduced blood insulin, and reduced triglyceride levels leading to improved insulin sensitivity and reductions in food intake.
Mechanism of action:  Metreleptin functions by binding to and activating the human leptin receptor (ObR), which belongs to the Class I cytokine family of receptors that signals through the JAK/STAT transduction pathway.
Affected organisms:  Humans and other mammals
Targets:  Target 1. Leptin receptor
Catalog# Product Name Inquiry
THP-0115 Recombinant human alpha-galactosidase A, Agalsidase alfa Inquiry
THP-0116 Recombinant Dipeptidyl peptidase-4-resistant glucagon-like peptide-1 dimer, Albiglutide Inquiry
THP-0117 Glucagon-like peptide-1 agonist (GLP-1) Inquiry
THP-0118 N-acetylgalactosamine-6-sulfatase Inquiry
THP-0119 Glucagon-Like peptide-1 (GLP-1) Inquiry


For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
Search

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © 2007 - 2021 Creative BioMart. All Rights Reserved.