| Cat#: | THP-0134 |
| Product Name: | Recombinant analog of the human hormone leptin |
| Description: | The product, a recombinant analog of the human hormone leptin. The product is produced in E. coli and differs from native human leptin by the addition of a methionine residue at its amino terminus. |
| Formula: | C714H1167N191O221S6 |
| Sequences: | MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
| Species: | Human |
| Source: | E. coli |
| CAS No. : | 186018-45-1 |
| Molecular Weight: | 16155.4429 Da |
| Synonyms: | Metreleptin; Metreleptina; Métréleptine; Metreleptinum; N-Methionylleptin; r-metHuLeptin |
| Drug name: | Metreleptin |
| Applications: | The product is indicated as an adjunct to diet as replacement therapy to treat the complications of leptin deficiency in patients with congenital or acquired generalized lipodystrophy. |
| Examples of Clinical Use: | Congenital or acquired generalized lipodystrophy |
| Pharmacodynamics : | In patients with leptin deficiency, clinical trials demonstrated that exogenous leptin administration results in weight loss, reduction in mean HbA1c and fasting glucose levels, reduced blood insulin, and reduced triglyceride levels leading to improved insulin sensitivity and reductions in food intake. |
| Mechanism of action: | Metreleptin functions by binding to and activating the human leptin receptor (ObR), which belongs to the Class I cytokine family of receptors that signals through the JAK/STAT transduction pathway. |
| Affected organisms: | Humans and other mammals |
| Targets: | Target 1. Leptin receptor |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| THP-0115 | Recombinant human alpha-galactosidase A, Agalsidase alfa | Inquiry |
| THP-0116 | Recombinant Dipeptidyl peptidase-4-resistant glucagon-like peptide-1 dimer, Albiglutide | Inquiry |
| THP-0117 | Glucagon-like peptide-1 agonist (GLP-1) | Inquiry |
| THP-0118 | N-acetylgalactosamine-6-sulfatase | Inquiry |
| THP-0119 | Glucagon-Like peptide-1 (GLP-1) | Inquiry |
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
