Recombinant human epidermal growth factor (rhEGF)


  • Specification
  • Drug Information
  • Related Products
Cat#:  THP-0303
Product Name:  Recombinant human epidermal growth factor (rhEGF)
Description:  Nepidermin (brand name Easyef), also known as recombinant human epidermal growth factor (rhEGF), is a recombinant form of human epidermal growth factor (EGF) and a cicatrizant (a drug that promotes wound healing through formation of scar tissue). It was developed by Daewoong Pharmaceutical. As a recombinant form of EGF, nepidermin is an agonist of the epidermal growth factor receptor (EGFR), and is the first EGFR agonist to be marketed.
Formula:  C270H401N73O83S7
Sequences:  NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Species:  Human
CAS No. :  62253-63-8
Synonyms:  Beta-urogastrone Epidermal growth factor (human) Epidermal growth factor biosynthetic human Epidermal growth factor human H-EGF Human EGF Human epidermal growth factor Human urogastrone
Drug name:  Nepidermin
Applications:  Upon topical application, recombinant human epidermal growth factor (rhEGF) may stimulate epithelial proliferation, differentiation and migration, which may result in the acceleration of epithelial regeneration and wound healing. In addition, rhEGF may attenuate epithelial cytotoxicities related to chemotherapy and/or radiotherapy.
Examples of Clinical Use:  Oral Mucositis; Colorectal Cancers
Catalog# Product Name Inquiry
THP-0292 Recombinant human basic fibroblast growth factor Inquiry


For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
Search

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © 2007 - 2021 Creative BioMart. All Rights Reserved.