Recombinant protein of ActRIIA and Fc domain of human IgG1 antibody


  • Specification
  • Drug Information
  • Related Products
Cat#:  THP-0319
Product Name:  Recombinant protein of ActRIIA and Fc domain of human IgG1 antibody
Description:  Sotatercept (ACE-011) is a recombinant fusion protein composed of the extracellular domain of the human activin receptor type IIA (ActRIIA) and the fragment crystallizable (Fc) domain of the human immunoglobulin G1 antibody.
Formula:  C3448H5264N920O1058S42
Sequences:  ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPTGGGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Species:  Human
CAS No. :  1001080-50-7
Molecular Weight:  77829.47 Da
Synonyms:  ACE-011; ActRIIa-hFc
Drug name:  Sotatercept
Applications:  Sotatercept has been used in trials studying the supportive care and treatment of Anemia, Leukemia, Solid Tumors, Bladder Cancer, and multiple myeloma, among others.
Examples of Clinical Use:  Anemia; Chronic Myelomonocytic Leukemia; Chronic Myelomonocytic Leukemia (CMML); Low to Intermediate-1 MDS; Myelodysplastic Syndromes (MDS)
Targets:  Activin receptor type-2A


For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
Search

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © 2007 - 2021 Creative BioMart. All Rights Reserved.