Cat# : THP-0319
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0319 | Sotatercept | April 19, 2024 | 10ug | $298.00 |
|
100ug | $1,598.00 |
|
|||
1mg | $3,998.00 |
|
|||
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0319 |
Product Name: | Sotatercept |
Description: | Sotatercept (ACE-011) is a recombinant fusion protein consisting of the extracellular domain of the human activin receptor type IIA linked to the Fc piece of human IgG1. |
Sequences: | ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPTGGGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Species: | Human |
Molecular Weight: | 77829.47 Da |
Cas No: | 1001080-50-7 |
Formula: | C3448H5264N920O1058S42 |
Endotoxin Level: | <0.1 EU per 1 μg of the peptide by the LAL method |
Publication: |
Antibody-based strategies for the detection of Luspatercept (ACE-536) in human serum (Reichel, C., Gmeiner, G., & Thevis, M.) (Drug Testing and Analysis) (2017).
Detection of Sotatercept (ACE-011) in human serum by SAR-PAGE and western single blotting (Reichel, C., Farmer, L., Gmeiner, G.,et al.) (Drug Testing and Analysis) (2017). Testing for the erythropoiesis-stimulating agent Sotatercept/ACE-011 (ActRIIA-Fc) in serum by means of Western blotting and LC-HRMS (Walpurgis, K., Thomas, A., Vogel, M.,et al.) (Drug Testing and Analysis) (2016). |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2024 Creative BioMart. All Rights Reserved.