Recombinant fusion protein of human VEGF and IgG1


  • Specification
  • Drug Information
  • Related Products
Cat#:  THP-0006
Product Name:  Recombinant fusion protein of human VEGF and IgG1
Description:  The product is a recombinant fusion protein that comprises of two main components: the vascular endothelial growth factor (VEGF) binding portions from the extracellular domains of human VEGF receptors 1 and 2 which is then fused to the Fc portion of human IgG1. Structurally, the product is a dimeric glycoprotein with a protein molecular weight of 96.9 kilo Daltons (kDa). It contains approximately 15% glycosylation to give a total molecular weight of 115 kDa. All five putative N-glycosylation sites on each polypeptide chain predicted by the primary sequence can be occupied with carbohydrate and exhibit some degree of chain heterogeneity, including heterogeneity in terminal sialic acid residues, except at the single unsialylated site associated with the Fc domain.
Formula:  C4318H6788N1164O1304S32
Sequences:  SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
Species:  Human
CAS No. :  862111-32-8
Molecular Weight:  115000.0 Da (with glycosylation)
Synonyms:  VEGF Trap; VEGF Trap-Eye; Ziv-Aflibercept
Drug name:  Aflibercept
Applications:  The opthalmic agent is used for the treatment of neovascular (wet) age-related mascular degeneration (AMD) and macular edema following central retinal vein occulsion (CRVO). The systemic injection, known as ziv-aflibercept, in combination with 5-fluorouracil, leucovorin, irinotecan-(FOLFIRI), is for the treatment of metastatic colorectal cancer that is resistant to or progressed following treatment with oxaliplatin.
Examples of Clinical Use:  Neovascular (wet) age-related mascular degeneration (AMD) and macular edema following central retinal vein occulsion (CRVO)
Pharmacodynamics :  Compared to other anti-VEGF drugs like bevacizumab and ranibizumab, the product has a higher binding affinity to VEGF-A (Kd = 0.5 pM).
Mechanism of action:  Ablibercept is a recombinant fusion protein that acts as a decoy receptor for the ligands, vascular endothelial growth factor-A (VEGF-A) and placental growth factor (PIGF). It prevents these ligands to binding to endothelial receptors, VEGFR-1 and VEGFR-2, to suppress neovascularization and decrease vascular permeability. This ultimately will slow vision loss or the progression of metastatic colorectal cancer.
Affected organisms:  Humans and other mammals
Targets:  Target 1. Vascular endothelial growth factor A; Target 2. Placenta growth factor; Target 3. Vascular endothelial growth factor B
Catalog# Product Name Inquiry
THP-0003 Human recombinant granulocyte macrophage colony-stimulating factor (GM-CSF) Inquiry
THP-0004 Human cytokine granulocyte-macrophage colony stimulating factor (GM-CSF) Inquiry
THP-0005 Recombinant thyroid stimulating hormone Inquiry
THP-0007 Human interleukin-2 Inquiry
THP-0008 Luteinizing hormone-releasing hormone (LHRH) Inquiry


For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
Search

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © 2007 - 2020 Creative BioMart. All Rights Reserved.