Inquiry Basket

Filgrastim, Recombinant human GCSF

Cat# : THP-0071

Product Datasheets COA :

Catalog#	Product Name	Availability	Size	Price	Qty
THP-0071	Filgrastim, Recombinant human GCSF	April 25, 2024	1 vial	$3,998.00
Add to Cart Online Order Request a Bulk Order

Related Products

Cat#:	THP-0071
Product Name:	Filgrastim, Recombinant human GCSF
Description:	The product is a recombinant, non-pegylated human granulocyte colony stimulating factor (G-CSF) analog.
Sequences:	MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Species:	Human
Molecular Weight:	18800.0 Da
Purity:	>99% by SDS-Page and HPLC analysis
Cas No:	121181-53-1
Formula:	C845H1343N223O243S9
Endotoxin Level:	<0.001 EU per 1 μg of the protein by the LAL method
Biological Activity:	48000000 U/0.5ml

Catalog#	Product Name	Size	Price	Inquiry
THP-1108	Recombinant stabilized RSV B prefusion F antigen			Inquiry
THP-1102	Cipaglucosidase alfa; Recombinant Human acid alpha-glucosidase			Inquiry
THP-1101	Pegunigalsidase alfa; Recombinant Human α-galactosidase-A			Inquiry
THP-1104	Efanesoctocog alfa; Recombinant DNA-derived, Factor VIII; F8			Inquiry
THP-1100	Velmanase alfa;Recombinant Human Lysosomal alpha-mannosidase			Inquiry
THP-0067	Recombinant Human Erythropoietin	1 vial	$3,998.00	Add to Cart Order
THP-0058	Coagulation Factor IX Human/F9	1 vial	$2,998.00	Add to Cart Order
THP-0052	Recombinant Human F8/Antihemophilic factor	100IU	$698.00	Add to Cart Order
THP-0071	Filgrastim, Recombinant human GCSF	1 vial	$3,998.00	Add to Cart Order
THP-9328	Recombinant Human Hyaluronidase PH20, Fc-tagged	1KU	$398	Add to Cart Order

For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Pharmaceutical Application:	Filgrastim
Applications:	This drug is a leucocyte growth factor indicated to:Decrease the incidence of infection‚ as manifested by febrile neutropenia‚in patients with nonmyeloid malignancies receiving myelosuppressive anti-cancer drugs associated with a significant incidence of severe neutropenia with fever. Reduce the time to neutrophil recovery and the duration of fever, following induction or consolidation chemotherapy treatment in patients with acute myeloid leukemia (AML)Reduce the duration of neutropenia and neutropenia-related clinical sequelae‚ e.g.‚ febrile neutropenia, in patients with nonmyeloid malignancies undergoing myeloablative chemotherapy followed by bone marrow transplantation (BMT)Mobilize autologous hematopoietic progenitor cells into the peripheral blood for collection by leukapheresisReduce the incidence and duration of sequelae of severe neutropenia (e.g.‚ fever‚ infections‚ oropharyngeal ulcers) in symptomatic patients with congenital neutropenia‚ cyclic neutropenia‚ or idiopathic neutropenia.Neupogen is approved for treatment of patients with radiation-induced myelosuppression following a radiological/nuclear incident.
Examples of Clinical Use:	Radiation-induced myelosuppression
Pharmacodynamics:	The product binds to the G-CSF receptor and stimulates the production of neutrophils in the bone marrow.Colony-stimulating factors are glycoproteins which act on hematopoietic cells by binding to specific cell surface receptors, in turn, stimulating proliferation and differentiation.G-CSF and its receptor are necessary for basal and stress-induced granulopoiesis, which forms neutrophils. Mice deficient in G-CSF or G-CSFR have severe neutropenia and reduced levels (~50%) of late-stage neutrophil precursors in the bone marrow under normal, resting conditions.Endogenous G-CSF is a lineage-specific colony-stimulating factor that is produced by monocytes‚ fibroblasts, and endothelial cells. G-CSF regulates the production of neutrophils within the bone marrow and enhances neutrophil progenitor proliferation‚ differentiation, and selected end-cell functions (including enhanced phagocytic ability‚ priming of the cellular metabolism associated with respiratory burst‚ antibody-dependent killing, and enhanced expression of certain cell surface antigens). G-CSF is not species-specific and has demonstrated to have negligible direct in vivo or in vitro effects on the production or action of hematopoietic cell types other than the neutrophil and its lineage.
Mechanism of action:	As a G-CSF analog, this drug controls the proliferation of committed progenitor cells and influences their maturation into mature neutrophils. Filgrastim also stimulates the release of neutrophils from bone marrow storage pools and decreases their time to maturation. Filgrastim acts to increase the phagocytic activity of mature neutrophils, thus allowing them to prevent infection. In patients receiving cytotoxic chemotherapy, filgrastim may accelerate neutrophil recovery, leading to a reduction in the duration of the neutropenic phase post chemotherapy.
Affected organisms:	Humans and other mammals
Targets:	Target 1. Granulocyte colony-stimulating factor receptor; Target 2. Neutrophil elastase

Filgrastim, Recombinant human GCSF

Specification

Pharmaceutical Information

Related Products

Online Inquiry