Human chorionic gonadotropin (HCG)


  • Specification
  • Drug Information
  • Related Products
Cat#:  THP-0140
Product Name:  Human chorionic gonadotropin (HCG)
Description:  Human chorionic gonadotropin (HCG), a polypeptide hormone produced by the human placenta. HCG is composed of an alpha and a beta sub-unit. The alpha sub-unit is essentially identical to the alpha sub­ units of the human pituitary gonadotropins, luteinizing hormone (LH) and follicle-stimulating hormone (FSH), as well as to the alpha sub-unit of human thyroid-stimulating hormone (TSH), while the beta sub­ units of these hormones differ in amino acid sequence.
Formula:  Not Available
Sequences:  APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSSKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Species:  Human
CAS No. :  9002-61-3
Molecular Weight:  Not Available
Synonyms:  Chorionic gonadotrophin; Chorionic gonadotropin; Gonadotropin, Chorionic; Gonadotropin,chorionic; h-HCG; hCGHuman chorionic gonadotropin; Human menopausal gonadotropin; Human menopausal gonadotropin (urine derived); Human-chorionic gonadotropin; Urinary hCG
Drug name:  Chorionic Gonadotropin (Human)
Applications:  For the treatment of prepubertal cryptorchidism (not due to anatomical obstruction), for the treatment of selected cases of hypogonadotropic hypogonadism (hypogonadism secondary to a pituitary deficiency) in males and for the induction of ovulation and pregnancy in the anovulatory, infertile woman in whom the cause of anovulation is secondary and not due to primary ovarian failure, and who has been appropriately pretreated with human menotropins.
Examples of Clinical Use:  Prepubertal cryptorchidism
Pharmacodynamics :  The action of HCG is virtually identical to that of pituitary LH, although HCG appears to have a small degree of FSH activity as well. It stimulates production of gonadal steroid hormones by stimulating the interstitial cells (Leydig cells) of the testis to produce androgens and the corpus luteum of the ovary to produce progesterone.
Mechanism of action:  Not Available
Affected organisms:  Not Available
Targets:  Target 1. Lutropin-choriogonadotropic hormone receptor
Catalog# Product Name Inquiry
THP-0139 Recombinant human chorionic gonadotropin Inquiry
THP-0141 Hybrid follicle-stimulating hormone (FSH) Inquiry
THP-0142 Human follicle stimulating hormone (FSH) Inquiry
THP-0143 Recombinant human luteinizing hormone Inquiry
THP-0144 Follicle stimulating hormone (FSH) and luteinizing hormone (LH) Inquiry


For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
Search

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © 2007 - 2021 Creative BioMart. All Rights Reserved.