| Cat#: | THP-0140 |
| Product Name: | Human chorionic gonadotropin (HCG) |
| Description: | Human chorionic gonadotropin (HCG), a polypeptide hormone produced by the human placenta. HCG is composed of an alpha and a beta sub-unit. The alpha sub-unit is essentially identical to the alpha sub units of the human pituitary gonadotropins, luteinizing hormone (LH) and follicle-stimulating hormone (FSH), as well as to the alpha sub-unit of human thyroid-stimulating hormone (TSH), while the beta sub units of these hormones differ in amino acid sequence. |
| Formula: | Not Available |
| Sequences: | APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSSKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ |
| Species: | Human |
| CAS No. : | 9002-61-3 |
| Molecular Weight: | Not Available |
| Synonyms: | Chorionic gonadotrophin; Chorionic gonadotropin; Gonadotropin, Chorionic; Gonadotropin,chorionic; h-HCG; hCGHuman chorionic gonadotropin; Human menopausal gonadotropin; Human menopausal gonadotropin (urine derived); Human-chorionic gonadotropin; Urinary hCG |
| Drug name: | Chorionic Gonadotropin (Human) |
| Applications: | For the treatment of prepubertal cryptorchidism (not due to anatomical obstruction), for the treatment of selected cases of hypogonadotropic hypogonadism (hypogonadism secondary to a pituitary deficiency) in males and for the induction of ovulation and pregnancy in the anovulatory, infertile woman in whom the cause of anovulation is secondary and not due to primary ovarian failure, and who has been appropriately pretreated with human menotropins. |
| Examples of Clinical Use: | Prepubertal cryptorchidism |
| Pharmacodynamics : | The action of HCG is virtually identical to that of pituitary LH, although HCG appears to have a small degree of FSH activity as well. It stimulates production of gonadal steroid hormones by stimulating the interstitial cells (Leydig cells) of the testis to produce androgens and the corpus luteum of the ovary to produce progesterone. |
| Mechanism of action: | Not Available |
| Affected organisms: | Not Available |
| Targets: | Target 1. Lutropin-choriogonadotropic hormone receptor |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| THP-0139 | Recombinant human chorionic gonadotropin | Inquiry |
| THP-0141 | Hybrid follicle-stimulating hormone (FSH) | Inquiry |
| THP-0142 | Human follicle stimulating hormone (FSH) | Inquiry |
| THP-0143 | Recombinant human luteinizing hormone | Inquiry |
| THP-0144 | Follicle stimulating hormone (FSH) and luteinizing hormone (LH) | Inquiry |
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
