Cat# : THP-0203
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0203 | Alfimeprase, Recombinant fibrolase | May 18, 2024 | 1 vial | $3,998.00 |
|
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0203 |
Product Name: | Alfimeprase, Recombinant fibrolase |
Description: | The product is a recombinant analog of fibrolase. Fibrolase is a zinc-containing metalloproteinase isolated from the venom of the southern copperhead snake (Agkistrodon contortrix contortrix). It is a small protein that contains 203 residues. |
Sequences: | SFPQRYVQLVIVADHRMNTKYNGDSDKIRQWVHQIVNTINEIYRPLNIQFTLVGLEIWSNQDLITVTSVSHDTLASFGNWRETDLLRRQRHDNAQLLTAIDFDGDTVGLAYVGGMCQLKHSTGVIQDHSAINLLVALTMAHELGHNLGMNHDGNQCHCGANSCVMAAMLSDQPSKLFSDCSKKDYQTFLTVNNPQCILNKP |
Species: | Agkistrodon contortrix contortrix |
Molecular Weight: | Not Available |
Purity: | >99% by SDS-Page and HPLC analysis |
Cas No: | 259074-76-5 |
Formula: | Not Available |
Endotoxin Level: | <0.1 EU per 1 μg of the protein by the LAL method |
Storage: | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 °C for 1 week. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2024 Creative BioMart. All Rights Reserved.